Protein Info for PGA1_c01120 in Phaeobacter inhibens DSM 17395

Annotation: sulfite exporter tauE/safE-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 transmembrane" amino acids 7 to 33 (27 residues), see Phobius details amino acids 40 to 68 (29 residues), see Phobius details amino acids 89 to 108 (20 residues), see Phobius details amino acids 114 to 136 (23 residues), see Phobius details amino acids 147 to 166 (20 residues), see Phobius details amino acids 184 to 205 (22 residues), see Phobius details amino acids 211 to 229 (19 residues), see Phobius details amino acids 239 to 257 (19 residues), see Phobius details PF01925: TauE" amino acids 24 to 255 (232 residues), 97.8 bits, see alignment E=4e-32

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 73% identity to sit:TM1040_2445)

Predicted SEED Role

"Membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EIC3 at UniProt or InterPro

Protein Sequence (262 amino acids)

>PGA1_c01120 sulfite exporter tauE/safE-like protein (Phaeobacter inhibens DSM 17395)
MSDNSIVMLFLPAELISVHLLAAFAIAALAGAVKGMVGFAMPMILVSGLSLFLPPDIALA
GLILPTLVTNGMQALRQGGQAAWQSMKRFRIFLLIGLVFLLASAQLVRVLPQDIMLILIG
APITLFAVLQLFGIAIPISRATPRVEAIVAAFAGFIGGFSGIWGPPTVAYLTALGTEKRE
QMRVQGVIYGLGAVALLIAHIGSGVMRADTAPFSLLLIPPAICGMWIGGRLQDRINQVTF
RRATLVVLLVAGANLLRRGLMY