Protein Info for PGA1_c10910 in Phaeobacter inhibens DSM 17395

Annotation: dihydroorotase PyrC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 346 TIGR00856: dihydroorotase, homodimeric type" amino acids 5 to 345 (341 residues), 436 bits, see alignment E=4.3e-135 PF01979: Amidohydro_1" amino acids 12 to 321 (310 residues), 67.3 bits, see alignment E=7.4e-23

Best Hits

Swiss-Prot: 86% identical to PYRC_RUEST: Dihydroorotase (pyrC) from Ruegeria sp. (strain TM1040)

KEGG orthology group: K01465, dihydroorotase [EC: 3.5.2.3] (inferred from 86% identity to sit:TM1040_1776)

MetaCyc: 54% identical to dihydroorotase (Escherichia coli K-12 substr. MG1655)
Dihydroorotase. [EC: 3.5.2.3]

Predicted SEED Role

"Dihydroorotase (EC 3.5.2.3)" in subsystem De Novo Pyrimidine Synthesis (EC 3.5.2.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.2.3

Use Curated BLAST to search for 3.5.2.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DP49 at UniProt or InterPro

Protein Sequence (346 amino acids)

>PGA1_c10910 dihydroorotase PyrC (Phaeobacter inhibens DSM 17395)
MTVQLTIPRPDDWHLHLRDGAMLTAVLPETARDFARAIIMPNLVPPVVTGDQAAAYRDRI
LAALPDGMAFEPLMTLYLTEDTDPADVAAAHASGLVKAVKLYPAGATTNSASGVSDFDKV
RGVLETMADIGLPLCTHGEVTDHDIDIFDREAVFIDRVLDPIRKSTPGLRVVMEHITTKN
AADYVTSQDSDLGATITTHHLIINRNHILAGGIKPHYYCLPVAKREEHRLALRAAATSGD
RRFFLGTDSAPHTDPNKLSACGCAGCFTAPNTMPLLAHVFEEENALDKLAGFASENGPAF
YGLPVNAEKLTLEKQASPVTFPEQISTEDGPVTVFDPGFDVFWKVA