Protein Info for Psest_1106 in Pseudomonas stutzeri RCH2

Annotation: ribose-phosphate pyrophosphokinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details PF13793: Pribosyltran_N" amino acids 20 to 137 (118 residues), 170.6 bits, see alignment E=1.6e-54 TIGR01251: ribose-phosphate diphosphokinase" amino acids 20 to 329 (310 residues), 405.3 bits, see alignment E=7e-126 PF00156: Pribosyltran" amino acids 169 to 265 (97 residues), 72.5 bits, see alignment E=3.7e-24 PF14572: Pribosyl_synth" amino acids 217 to 329 (113 residues), 118.1 bits, see alignment E=6.8e-38

Best Hits

Swiss-Prot: 93% identical to KPRS_PSEAE: Ribose-phosphate pyrophosphokinase (prs) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00948, ribose-phosphate pyrophosphokinase [EC: 2.7.6.1] (inferred from 99% identity to psa:PST_3189)

MetaCyc: 68% identical to ribose-phosphate diphosphokinase (Escherichia coli K-12 substr. MG1655)
Ribose-phosphate diphosphokinase. [EC: 2.7.6.1]

Predicted SEED Role

"Ribose-phosphate pyrophosphokinase (EC 2.7.6.1)" in subsystem De Novo Purine Biosynthesis or Pentose phosphate pathway (EC 2.7.6.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.6.1

Use Curated BLAST to search for 2.7.6.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GIR3 at UniProt or InterPro

Protein Sequence (329 amino acids)

>Psest_1106 ribose-phosphate pyrophosphokinase (Pseudomonas stutzeri RCH2)
MNSFLFIGPTLRQVLRVSKMMVFTGNANPDLARRVVRQLHIPLGDAYVGKFSDGEISVEI
NENVRGKDVFLIQPTCAPTNDNLMELVVLADAFRRSSASRITAVIPYFGYARQDRRPRSA
RVPISAKVVADMLDVVGVNRVLTVDLHADQIQGFFDMPVDNIYGSPVLVDDIQAQRFENL
MIVSPDIGGVVRARAVAKSLGVDLAIIDKRRPKANQSEVMHIIGDIEGRTCILVDDMVDT
AGTLCHAAKALKDHGAAKVYAYCTHPILSGRAIENIEGSVLDELVVTNTIPLSAAAQSCT
RIRQLDIAPVVAEAVRRISNAESISAMFR