Protein Info for PGA1_c10710 in Phaeobacter inhibens DSM 17395

Annotation: putative sec-independent protein translocase protein TatB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 161 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details TIGR01410: twin arginine-targeting protein translocase TatB" amino acids 2 to 67 (66 residues), 66.6 bits, see alignment E=1.1e-22 PF02416: TatA_B_E" amino acids 2 to 48 (47 residues), 66 bits, see alignment E=8.6e-23

Best Hits

Swiss-Prot: 79% identical to TATB_RUEST: Sec-independent protein translocase protein TatB (tatB) from Ruegeria sp. (strain TM1040)

KEGG orthology group: K03117, sec-independent protein translocase protein TatB (inferred from 79% identity to sit:TM1040_1796)

Predicted SEED Role

"Twin-arginine translocation protein TatB" in subsystem Twin-arginine translocation system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EY34 at UniProt or InterPro

Protein Sequence (161 amino acids)

>PGA1_c10710 putative sec-independent protein translocase protein TatB (Phaeobacter inhibens DSM 17395)
MFDLGWTELMVIGVVALIVVGPKDLPVLFRNVGRFVGKAKGMAREFSRAMNDAADETGVN
DIAKGLKAAANPMNTAMDGVKQAAQDMAKSIDPTKFDPDSETGKLAAERAEDAKKIQAAT
ARAAADRKAREAAEAQAKAAEAEAALAAPDTPTTPESETNT