Protein Info for HP15_1029 in Marinobacter adhaerens HP15

Annotation: conserved hypothetical protein, membrane

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 426 transmembrane" amino acids 15 to 34 (20 residues), see Phobius details amino acids 46 to 65 (20 residues), see Phobius details amino acids 71 to 89 (19 residues), see Phobius details amino acids 106 to 135 (30 residues), see Phobius details amino acids 155 to 172 (18 residues), see Phobius details amino acids 186 to 207 (22 residues), see Phobius details amino acids 213 to 233 (21 residues), see Phobius details amino acids 245 to 269 (25 residues), see Phobius details amino acids 276 to 295 (20 residues), see Phobius details amino acids 316 to 337 (22 residues), see Phobius details amino acids 344 to 364 (21 residues), see Phobius details amino acids 372 to 391 (20 residues), see Phobius details amino acids 403 to 425 (23 residues), see Phobius details PF02308: MgtC" amino acids 18 to 143 (126 residues), 64.5 bits, see alignment E=1.2e-21 PF13194: DUF4010" amino acids 191 to 400 (210 residues), 221.7 bits, see alignment E=8.7e-70

Best Hits

KEGG orthology group: None (inferred from 85% identity to maq:Maqu_2103)

Predicted SEED Role

"FIG00785332: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PFP4 at UniProt or InterPro

Protein Sequence (426 amino acids)

>HP15_1029 conserved hypothetical protein, membrane (Marinobacter adhaerens HP15)
MDDVAAQFLAGNQTTLNLAVALLLGAIIGLERGWDAREQKSGERIAGIRTFALVGLLGGI
SALLAREITEWAFPVLLVSVVAMAIVAYSERLEHIRNFSITGMVGMVLTFCFGAVAVAVD
PVIATAAAVVTAIILDNKQEIHGWVNKLKEHELDAALKLLLISVVMLPLLPNEKMGPGGV
LNPREIWWMVVMIASISFVGYFAIRVAGTRKGILFTSLFAGLSSSTALTLHFARQASKTP
QLNAQFATGILIACGTMFPRILVYCLVINPDLLPSLIWPVLVMTALLYGPALVIWRKNDR
ELQVSQPTLNQNPLDLSSALVFGALLTAILLMGEFLGNWLGDAGIYFLAATSGIADVDAI
TLSLTRMSNNSLAMGTAVIGIVIAAATNNLVKSALAGFVGNRQIGLLVGGPMVLSLAAGL
LVAWLQ