Protein Info for Psest_1075 in Pseudomonas stutzeri RCH2

Annotation: Predicted transcriptional regulators

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 132 PF13411: MerR_1" amino acids 6 to 71 (66 residues), 57.6 bits, see alignment E=1.7e-19 PF00376: MerR" amino acids 7 to 38 (32 residues), 34.7 bits, see alignment E=1.9e-12 PF09278: MerR-DNA-bind" amino acids 49 to 113 (65 residues), 55.4 bits, see alignment E=1.1e-18

Best Hits

KEGG orthology group: None (inferred from 98% identity to psa:PST_3221)

Predicted SEED Role

"Predicted transcriptional regulator LiuR of leucine degradation pathway, MerR family" in subsystem HMG CoA Synthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GI09 at UniProt or InterPro

Protein Sequence (132 amino acids)

>Psest_1075 Predicted transcriptional regulators (Pseudomonas stutzeri RCH2)
MAKQTYSISDLANELDITTRAIRFYEEQGMLRPTRRGQERIYSPKDRVALKLILRGKRIG
FSLAECKTLIELYDPKAGNQKQLNIMLQMIAERRQQLEQQLLDIQQMQLELDTAEERCRS
ALESTLAKQAAS