Protein Info for HP15_1015 in Marinobacter adhaerens HP15

Annotation: cyanate lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 147 PF21291: CYNS_N" amino acids 7 to 72 (66 residues), 60.6 bits, see alignment E=1.2e-20 TIGR00673: cyanase" amino acids 7 to 147 (141 residues), 175.6 bits, see alignment E=3.1e-56 PF02560: Cyanate_lyase" amino acids 79 to 145 (67 residues), 129.2 bits, see alignment E=3.9e-42

Best Hits

Swiss-Prot: 66% identical to CYNS_TERTT: Cyanate hydratase (cynS) from Teredinibacter turnerae (strain ATCC 39867 / T7901)

KEGG orthology group: K01725, cyanate lyase [EC: 4.2.1.104] (inferred from 68% identity to tcx:Tcr_0040)

MetaCyc: 43% identical to cyanase (Escherichia coli K-12 substr. MG1655)
Cyanase. [EC: 4.2.1.104]

Predicted SEED Role

"Cyanate hydratase (EC 4.2.1.104)" in subsystem Cyanate hydrolysis (EC 4.2.1.104)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.104

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PFN0 at UniProt or InterPro

Protein Sequence (147 amino acids)

>HP15_1015 cyanate lyase (Marinobacter adhaerens HP15)
MMNKELMTAKILEAKVSKGMTWESIAETIGMSPVFTTSAALGMNSLTEDKAFALCEILGL
DKPVAEALQVCPKKAWDGAVPQDPLIYRLYEVVGVYGDTMKELIHEKFGDGIMSAIDFTM
DIEKEENPKGDRVVVTMNGKFLPYKAW