Protein Info for HP15_1012 in Marinobacter adhaerens HP15

Annotation: nitrate transporter component, NrtA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 473 transmembrane" amino acids 82 to 101 (20 residues), see Phobius details amino acids 122 to 140 (19 residues), see Phobius details TIGR01409: Tat (twin-arginine translocation) pathway signal sequence" amino acids 79 to 100 (22 residues), 20.5 bits, see alignment (E = 2.3e-08) PF13379: NMT1_2" amino acids 115 to 353 (239 residues), 312.4 bits, see alignment E=3.1e-97 PF09084: NMT1" amino acids 132 to 343 (212 residues), 23 bits, see alignment E=6.7e-09

Best Hits

KEGG orthology group: K02051, sulfonate/nitrate/taurine transport system substrate-binding protein (inferred from 70% identity to cja:CJA_0009)

Predicted SEED Role

"Cyanate ABC transporter, substrate binding protein" in subsystem Cyanate hydrolysis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PFM7 at UniProt or InterPro

Protein Sequence (473 amino acids)

>HP15_1012 nitrate transporter component, NrtA (Marinobacter adhaerens HP15)
MTTKSLGNPFDGDKSLIHAKTCGCPECKPGDSTPSISLDLKPSTGQQAVADEHLDSEAMM
DRAIEGAVVRSVFGHNEHSRRAFMKMMGAGTAAAVLGSVFPMEKAKAAVKESLGKLEKTK
LNVGFVPITCATPIIMAHPMGFYERYGLDVTVTKTAGWAVARDKSLAGEYDASHMLTPMP
LAMTMGAGSTPEPFIMPAVENINGQAIVLHVDHKDKRDPKQWKGFKFGVPFEYSMHNFLL
RYYLAENGIDPDKDVQIRVVPPPEMVANLRAGNLDGYLSPDPFNQRAVWEKVGFIHMLTK
DIWEGHPCCAFACSKQFATQNPNTYGALLRAIIDATQYSNNPDNRKEISEAIAPKNYLNQ
PVPVIQQVLTGYYADGLGEVKDVPDRIDFDPFPWHSMGVWILTQMKRWGYIEGDVDYKGI
AEQVYLASETGKIMEELGYTAPDKTYKTHTIMGKTFDSDRAEEYARSFDIGRV