Protein Info for HP15_1010 in Marinobacter adhaerens HP15

Annotation: sodium-dependent transporter, NSS family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 49 to 70 (22 residues), see Phobius details amino acids 92 to 115 (24 residues), see Phobius details amino acids 140 to 156 (17 residues), see Phobius details amino acids 168 to 188 (21 residues), see Phobius details amino acids 210 to 233 (24 residues), see Phobius details amino acids 245 to 269 (25 residues), see Phobius details amino acids 296 to 319 (24 residues), see Phobius details amino acids 337 to 356 (20 residues), see Phobius details amino acids 376 to 396 (21 residues), see Phobius details amino acids 417 to 437 (21 residues), see Phobius details PF00209: SNF" amino acids 12 to 128 (117 residues), 99.2 bits, see alignment E=1.2e-32 amino acids 159 to 434 (276 residues), 79.6 bits, see alignment E=1.1e-26

Best Hits

KEGG orthology group: K03308, neurotransmitter:Na+ symporter, NSS family (inferred from 75% identity to dol:Dole_2269)

Predicted SEED Role

"sodium-dependent transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PFM5 at UniProt or InterPro

Protein Sequence (445 amino acids)

>HP15_1010 sodium-dependent transporter, NSS family protein (Marinobacter adhaerens HP15)
MRKRHEFIEESRKQWSSEPAFVASMAAAAVGLGNLWRFPYMVGENGGGAFVVAYLLALIV
VVLPIMILEVSAGRLSKGSTVQTYRQVNRFGVVYGWFVVLITVAITSYYLVITGWTLGYA
VDAATNNLQVFDDFTAGYNSLWYFFAVTVVGAIILAKDVTAIELLSKILMPVLIVVMIGL
VILASRTSGWEQTKDFFFQVDWSRLTDGKLWAFAFGQAFYSLAIGQGYLVTYGSFIPRQT
HVPRACLIVAGTETSVALLAGWMIFPFVFSLGMEPTEGSQLAFVTMPRVFEDMAGGYWVG
TLFFSLFFMAAFSSSLAGLKVMIAAVAEEFRLSNGKAVSLVTLMMLVLGTASALSFTPLE
WNIAGEPVLDVIDRVAGGNVIIFSGVLGAALFCWFIPPEKIRTVLGTQSRWWEWRIYLIG
RYLPLVMLFWIVVTYALNQVGITPA