Protein Info for Psest_1056 in Pseudomonas stutzeri RCH2

Annotation: 2-isopropylmalate synthase, bacterial type

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 514 PF00682: HMGL-like" amino acids 6 to 275 (270 residues), 331.6 bits, see alignment E=5.2e-103 TIGR00973: 2-isopropylmalate synthase" amino acids 6 to 499 (494 residues), 739.2 bits, see alignment E=9.7e-227 PF22617: HCS_D2" amino acids 289 to 369 (81 residues), 99 bits, see alignment E=2.5e-32 PF08502: LeuA_dimer" amino acids 371 to 500 (130 residues), 132.2 bits, see alignment E=1.6e-42

Best Hits

Swiss-Prot: 74% identical to LEU1_NITMU: 2-isopropylmalate synthase (leuA) from Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)

KEGG orthology group: K01649, 2-isopropylmalate synthase [EC: 2.3.3.13] (inferred from 98% identity to psa:PST_3240)

MetaCyc: 51% identical to 2-isopropylmalate synthase (Escherichia coli K-12 substr. MG1655)
2-isopropylmalate synthase. [EC: 2.3.3.13]

Predicted SEED Role

"2-isopropylmalate synthase (EC 2.3.3.13)" in subsystem Branched-Chain Amino Acid Biosynthesis or Leucine Biosynthesis (EC 2.3.3.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.3.13

Use Curated BLAST to search for 2.3.3.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GFW2 at UniProt or InterPro

Protein Sequence (514 amino acids)

>Psest_1056 2-isopropylmalate synthase, bacterial type (Pseudomonas stutzeri RCH2)
MSSNDRVIIFDTTLRDGEQSPGASMTAEEKLRIARALERLKVDVIEAGFAIASPGDFAAV
KLVADNIKDSTVCSLARAVDADIERAAEALAGANSGRIHTFIATSPIHMQYKLRMQPDQV
VEQAVRAVKKARSLCADVEFSCEDAGRSEIDFLCRIIKAAIDAGARTINIPDTVGYAIPH
QYADTIRQLLERIPNADKAVFSVHCHNDLGLAVANSLAAVVAGARQVECTINGLGERAGN
AALEEIVMAIKTRQDLINVHTRIETEHILAASRLVSGITGFPVQPNKAIVGANAFAHESG
IHQDGVLKHRETYEIMSAQSVGWNANKMVMGKHSGRAAFRSRLDELGIVLEGDELNAAFA
RFKELADKKHEIFDEDLQALVSDTLADEAPEHFKLASLEVASKTGTIPEAKLVISVDGAE
RSAQAQGSGPVDATFKAIEAVAESGATLQLYSVNAITQGTDSQGEVTVRLEKGGRIVNGN
GADTDIVVASAKAYLNALNLMQVGAKAHPQVEGV