Protein Info for PGA1_c01040 in Phaeobacter inhibens DSM 17395

Annotation: holo-[acyl-carrier-protein] synthase AcpS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 143 TIGR00556: phosphopantetheine--protein transferase domain" amino acids 1 to 129 (129 residues), 70.5 bits, see alignment E=1.4e-23 TIGR00516: holo-[acyl-carrier-protein] synthase" amino acids 1 to 129 (129 residues), 89.7 bits, see alignment E=1.8e-29 PF01648: ACPS" amino acids 4 to 92 (89 residues), 58.7 bits, see alignment E=2.8e-20

Best Hits

Swiss-Prot: 89% identical to ACPS_RUEPO: Holo-[acyl-carrier-protein] synthase (acpS) from Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)

KEGG orthology group: K00997, holo-[acyl-carrier protein] synthase [EC: 2.7.8.7] (inferred from 89% identity to sil:SPO3200)

Predicted SEED Role

"Holo-[acyl-carrier protein] synthase (EC 2.7.8.7)" in subsystem Fatty Acid Biosynthesis FASII (EC 2.7.8.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EVM9 at UniProt or InterPro

Protein Sequence (143 amino acids)

>PGA1_c01040 holo-[acyl-carrier-protein] synthase AcpS (Phaeobacter inhibens DSM 17395)
MILGVGTDLANIERIQRTLDRFGDRFRNRVFTDIEQRKAERRMDVAGTYAKRWAAKEACS
KALGTGLRMGIAWKDMAVSNLRTGQPVMHVTGWAADRLAKMTPPEHEAIIHVTLTDDHPW
AQAFVVIEARPIAREPLATPGDA