Protein Info for Psest_1049 in Pseudomonas stutzeri RCH2

Annotation: Uncharacterized paraquat-inducible protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 207 transmembrane" amino acids 47 to 69 (23 residues), see Phobius details amino acids 93 to 121 (29 residues), see Phobius details amino acids 141 to 164 (24 residues), see Phobius details amino acids 171 to 191 (21 residues), see Phobius details PF04403: PqiA" amino acids 46 to 200 (155 residues), 186.9 bits, see alignment E=1.2e-59

Best Hits

KEGG orthology group: K03808, paraquat-inducible protein A (inferred from 99% identity to psa:PST_3247)

Predicted SEED Role

"Paraquat-inducible protein A" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GHY7 at UniProt or InterPro

Protein Sequence (207 amino acids)

>Psest_1049 Uncharacterized paraquat-inducible protein A (Pseudomonas stutzeri RCH2)
MRAADAGLMVCHECHQLNRADAGQRHQRCIRCGARVHMRRPNSIVRTWALLITAALLYLP
ANLLPIMTVRMLGSGTPDTIMSGVVTLAKHGMFPIAAVVFIASILVPTFKLVGIAMLLFS
VQRHHPMSPRQRILVFRFIEWIGRWSMLDIFVIAILVAIVNFGSLASVEAGFGAIAFASV
VILTMLAAITFDPRLIWDNTESGNKHD