Protein Info for PGA1_c10300 in Phaeobacter inhibens DSM 17395

Annotation: acetyl-coenzyme A synthetase AcsA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00501: AMP-binding
  • amino acids 29 to 377 (349 residues), 195.7 bits, E=1.2e-61
• PF13193: AMP-binding_C
  • amino acids 426 to 501 (76 residues), 80.6 bits, E=1.3e-26

Best Hits

KEGG orthology group: K01895, acetyl-CoA synthetase [EC: 6.2.1.1] (inferred from 79% identity to sit:TM1040_0735)

Predicted SEED Role

"Acetyl-coenzyme A synthetase (EC 6.2.1.1)" in subsystem Ketoisovalerate oxidoreductase or Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate (EC 6.2.1.1)

MetaCyc Pathways

• ethanol degradation II (3/3 steps found)
• ethanol degradation IV (3/3 steps found)
• superpathway of acetate utilization and formation (3/3 steps found)
• acetate and ATP formation from acetyl-CoA III (1/1 steps found)
• acetate conversion to acetyl-CoA (1/1 steps found)
• L-isoleucine biosynthesis V (2/3 steps found)
• ethanol degradation III (2/3 steps found)
• reductive glycine pathway of autotrophic CO₂ fixation (6/9 steps found)
• chitin deacetylation (2/4 steps found)
• adlupulone and adhumulone biosynthesis (1/6 steps found)
• colupulone and cohumulone biosynthesis (1/6 steps found)
• lupulone and humulone biosynthesis (1/6 steps found)
• cis-geranyl-CoA degradation (2/9 steps found)
• superpathway of bitter acids biosynthesis (3/18 steps found)

KEGG Metabolic Maps

• Glycolysis / Gluconeogenesis
• Propanoate metabolism
• Pyruvate metabolism
• Reductive carboxylate cycle (CO2 fixation)

Isozymes

Compare fitness of predicted isozymes for: 6.2.1.1

Use Curated BLAST to search for 6.2.1.1

Sequence Analysis Tools

See I7EKL4 at UniProt or InterPro

Protein Sequence (516 amino acids)

>PGA1_c10300 acetyl-coenzyme A synthetase AcsA (Phaeobacter inhibens DSM 17395)
MSGVGGHTLYPGLRTDGGWQFPSCLNMAAQALDHPDEQLALIDLTTGARRDIRYGELRQM
VDAVARDLMQRVQPGDRVGVLLSQSVDCAVAHLAIWKIGAISVPLFKLFQHDALASRIGD
AGLELVLTDGGGTAQLGSLAQPLLVADILSASTGQSDHLLPYAETTPETPAVLIYTSGTT
GSAKGALHGHRVLSGHLPGVAISHDHLGQPGDCLWTPADWAWIGGLFDVLMPGLALGVPV
VAARLDKFTPEACAEIIRQGDVRNVFFPPTALRLLKAAGQGLDGLRSVASGGEPLGAEML
AWGQRHLGVTINEFYGQTECNMTVSSCVADFPVRPGCIGRPVPGCTVEVLDDTGTPTKDE
GDVAVRRGAASMMLEYWNRPDATAEKFHADWLITGDRGIWEGDYLRFVGREDDVITSAGY
RIGPAEIEDCLMTHPAVATVGVVGKPDELRTEIVKAYVVLKPGHSPSESDLQDYVKSRLA
KYSYPREVEFLDALPMTVTGKVIRKELKARAAGKVN