Protein Info for Psest_1041 in Pseudomonas stutzeri RCH2

Annotation: Predicted membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 206 transmembrane" amino acids 5 to 26 (22 residues), see Phobius details amino acids 43 to 63 (21 residues), see Phobius details amino acids 75 to 95 (21 residues), see Phobius details amino acids 110 to 127 (18 residues), see Phobius details amino acids 147 to 164 (18 residues), see Phobius details amino acids 170 to 195 (26 residues), see Phobius details PF01794: Ferric_reduct" amino acids 46 to 155 (110 residues), 62.7 bits, see alignment E=1.9e-21

Best Hits

Swiss-Prot: 62% identical to MSRQ_PSESM: Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ (msrQ) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: None (inferred from 80% identity to psa:PST_3253)

MetaCyc: 41% identical to membrane-bound flavocytochrome MsrQ (Escherichia coli K-12 substr. MG1655)
1.8.5.M7 [EC: 1.8.5.M7]; 1.8.5.M7 [EC: 1.8.5.M7]

Predicted SEED Role

"FIG001196: Membrane protein YedZ"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.5.M7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GFV2 at UniProt or InterPro

Protein Sequence (206 amino acids)

>Psest_1041 Predicted membrane protein (Pseudomonas stutzeri RCH2)
MRYRWWRLAVFVSALSVPLYWLYLAWQFALGPDPGKVLVDNLGQGALVLLLLTLSMTPLQ
RLTGWGGWLAARRQLGLWCFTYGLLHLASYLYFLLGGELSRLGGELLERPYILVGALGFS
GLAALAMTSSKWSMRRLGKRWKALHRLIYPIVIIVLLHMLWVVRSDSARWFLYAGIAAVL
LLLRVPVMATALASVRGRMKARTKLK