Protein Info for PGA1_c10240 in Phaeobacter inhibens DSM 17395

Annotation: bifunctional enzyme GlmU

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 451 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details TIGR01173: UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase" amino acids 4 to 434 (431 residues), 513.3 bits, see alignment E=2.9e-158 PF01128: IspD" amino acids 4 to 238 (235 residues), 39.6 bits, see alignment E=1.6e-13 PF12804: NTP_transf_3" amino acids 6 to 131 (126 residues), 71.8 bits, see alignment E=2.4e-23 PF00483: NTP_transferase" amino acids 6 to 172 (167 residues), 45.5 bits, see alignment E=2.2e-15 PF00132: Hexapep" amino acids 264 to 296 (33 residues), 27.8 bits, see alignment (E = 4.6e-10) PF14602: Hexapep_2" amino acids 378 to 411 (34 residues), 20.8 bits, see alignment 7.5e-08

Best Hits

Swiss-Prot: 78% identical to GLMU_RUEST: Bifunctional protein GlmU (glmU) from Ruegeria sp. (strain TM1040)

KEGG orthology group: K04042, bifunctional UDP-N-acetylglucosamine pyrophosphorylase / Glucosamine-1-phosphate N-acetyltransferase [EC: 2.3.1.157 2.7.7.23] (inferred from 78% identity to sit:TM1040_0728)

Predicted SEED Role

"N-acetylglucosamine-1-phosphate uridyltransferase (EC 2.7.7.23) / Glucosamine-1-phosphate N-acetyltransferase (EC 2.3.1.157)" in subsystem Peptidoglycan Biosynthesis or Sialic Acid Metabolism or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 2.3.1.157, EC 2.7.7.23)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.157 or 2.7.7.23

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EVE5 at UniProt or InterPro

Protein Sequence (451 amino acids)

>PGA1_c10240 bifunctional enzyme GlmU (Phaeobacter inhibens DSM 17395)
MSTALVILAAGKGTRMNSDLPKVLHPIAHAPMLEHALSAGRALTPERTIVVAGHGADYVR
SMMADIDEDAEIVVQEEQLGTAHAVAQTRDALSDFDGDIVVLYGDTPFVSAETLQRMLAA
RQSADLVVLGFTATDPARYGRLLMDGNSLERIVEYKDATEAEREIDFCNSGLMAGNAAQM
FALIDQVDSANASGEYYLTDLVELARADGLQVTAVSCDEAETLGINSRADLAEADRVFQQ
RKRADLMADGVTLMDPKTVYLAFDTVIGRDTIIEPNVVFGPEVTVESGVFIRSFSHFEGC
HISRGSKVGPYARLRPGAELAENTHIGNFVEIKNAEIAEGAKVNHLSYIGDASVGAETNI
GAGTITCNYDGVMKHRTEIGARAFIGSNTMLVAPVRIGDEAMTATGAVVTKSVEDGALAI
ARAEQKNKLGRARKLMDMLRAKKARLSKGAE