Protein Info for PGA1_c00010 in Phaeobacter inhibens DSM 17395

Annotation: chromosomal replication initiator protein DnaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 475 PF11638: DnaA_N" amino acids 5 to 62 (58 residues), 54.7 bits, see alignment 1.6e-18 TIGR00362: chromosomal replication initiator protein DnaA" amino acids 6 to 473 (468 residues), 533.8 bits, see alignment E=1.8e-164 PF00308: Bac_DnaA" amino acids 135 to 356 (222 residues), 286.2 bits, see alignment E=5.3e-89 PF01695: IstB_IS21" amino acids 170 to 270 (101 residues), 30.4 bits, see alignment E=7.2e-11 PF00004: AAA" amino acids 172 to 273 (102 residues), 29.3 bits, see alignment E=2.7e-10 PF08299: Bac_DnaA_C" amino acids 384 to 452 (69 residues), 105.3 bits, see alignment E=3.4e-34

Best Hits

Predicted SEED Role

"Chromosomal replication initiator protein DnaA" in subsystem DNA-replication

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EVE6 at UniProt or InterPro

Protein Sequence (475 amino acids)

>PGA1_c00010 chromosomal replication initiator protein DnaA (Phaeobacter inhibens DSM 17395)
MTEDNWGRLRQRLLKTVGQNNFTTWIEPLEFTCVENGVAIFNVPTNFMGNYVSQNFADLI
LHELNMSGEPVQRLAFRVAANTAARPTAVDAAGAADDLPLDLDDEALTDLPRARTATGHG
AAPKDQGETLQAAPLDPRFTFDSFVVGKPNELAHAAARRVAEGGPVTFNPLVLYGGVGLG
KTHLMHAIAWELTARNPELNVLYLSAEQFMYRFVQALRERKMMDFKHLFRSVDVLMVDDV
QFIAGKDSTQEEFFHTFNALVDQNKQIIISADRAPGEIKDLEDRVRSRLQCGLVVDLHPT
DYELRLGILQSKVAQQMQTYPDLRIADGVLEFLAHRISTNVRVLEGALTRLFAFASLVGR
EIDMELTQDCLADVLRASERKITVEEIQRKVSEYYNIRMSDIIGPKRLRSYARPRQVAMY
LCKQLTSRSLPEIGRRFGGRDHTTVMHGVRRIEELKTIDGQIAEDVEMLRRSLEA