Protein Info for EX31_RS24325 in Rahnella sp. WP5

Annotation: LpxL/LpxP family Kdo(2)-lipid IV(A) lauroyl/palmitoleoyl acyltransferasee

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03279: Lip_A_acyltrans
  • amino acids 5 to 297 (293 residues), 369.5 bits, E=5.8e-115
• TIGR02207: lipid A biosynthesis lauroyl (or palmitoleoyl) acyltransferase
  • amino acids 5 to 306 (302 residues), 484.1 bits, E=9e-150

Best Hits

Swiss-Prot: 65% identical to LPXL_ECOLI: Lipid A biosynthesis lauroyltransferase (lpxL) from Escherichia coli (strain K12)

KEGG orthology group: K02517, lipid A biosynthesis lauroyl acyltransferase [EC: 2.3.1.-] (inferred from 100% identity to rah:Rahaq_2979)

MetaCyc: 65% identical to lauroyl acyltransferase (Escherichia coli K-12 substr. MG1655)
LAUROYLACYLTRAN-RXN [EC: 2.3.1.241]

Predicted SEED Role

"Lipid A biosynthesis lauroyl acyltransferase (EC 2.3.1.-)" in subsystem KDO2-Lipid A biosynthesis (EC 2.3.1.-)

MetaCyc Pathways

• superpathway of (Kdo)₂-lipid A biosynthesis (17/17 steps found)
• (Kdo)₂-lipid A biosynthesis (E. coli) (2/2 steps found)
• superpathway of Kdo₂-lipid A biosynthesis (18/25 steps found)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Alkaloid biosynthesis I
• Alkaloid biosynthesis II
• Anthocyanin biosynthesis
• Benzoate degradation via CoA ligation
• Biosynthesis of terpenoids and steroids
• Biosynthesis of type II polyketide backbone
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Carotenoid biosynthesis - General
• Diterpenoid biosynthesis
• Ether lipid metabolism
• Ethylbenzene degradation
• Fatty acid biosynthesis
• Glycerophospholipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Histidine metabolism
• Limonene and pinene degradation
• Lipopolysaccharide biosynthesis
• Lysine degradation
• Phenylalanine metabolism
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.- or 2.3.1.241

Protein Sequence (311 amino acids)

>EX31_RS24325 LpxL/LpxP family Kdo(2)-lipid IV(A) lauroyl/palmitoleoyl acyltransferasee (Rahnella sp. WP5)
MTQVPTFNRSLLHPRYWITWMGLGLLYALVLLPYPVIYRIGTGLGRFSMRFLKRRYKIAR
RNIELCFPDMRPEQREDMIVKNFESVGMGLFETGMAWFWPDWRIERWFKVSGLEHIQHAR
DNKQGVLLIGVHFLTLELGARIFGIHNPGVGVYRPHDNKLMDWIQTKGRMRSNKGMLDRK
DLKGMIRSLKQGDIIWYAPDHDYGPRASVFVPFFAVDKAATTTGTYLLARMGKPAIIPFT
PRRLPKGEGYEMIIHPQVADFPLDDEVVAATYMNKVVENEICQAPEQYMWLHRRFKTRPQ
GEPSLYKALSD