Protein Info for EX31_RS21705 in Rahnella sp. WP5

Annotation: ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01096: lysine-arginine-ornithine-binding periplasmic protein
  • amino acids 7 to 250 (244 residues), 271.6 bits, E=3.2e-85
• PF00497: SBP_bac_3
  • amino acids 25 to 251 (227 residues), 204.3 bits, E=1.8e-64
• PF09084: NMT1
  • amino acids 103 to 181 (79 residues), 23.7 bits, E=4.2e-09

Best Hits

Swiss-Prot: 52% identical to ARGT_ECOLI: Lysine/arginine/ornithine-binding periplasmic protein (argT) from Escherichia coli (strain K12)

KEGG orthology group: K10013, lysine/arginine/ornithine transport system substrate-binding protein (inferred from 99% identity to rah:Rahaq_3460)

Predicted SEED Role

"Lysine-arginine-ornithine-binding periplasmic protein precursor (TC 3.A.1.3.1)" in subsystem Arginine and Ornithine Degradation (TC 3.A.1.3.1)

Protein Sequence (259 amino acids)

>EX31_RS21705 ABC transporter substrate-binding protein (Rahnella sp. WP5)
MNKIPLLIIAALSATSGLAHAETTLRFGVDPSFPPFESKAPDGKLVGFDIDLGNAICQQA
KVKCEWVETAYDGIIPALNAKKFDAVLSAMSMTPKRKTQVTFSDMLYHVPSVLIAKKGSG
LQPTADSLKGKTVGVAQGTTQEAYAQGEWQKKGVDVVSYQNQDFVNQDLASGRIDVTLTN
AAAAETGFLKTPEGTGYAFAGEPLNDTRYLGEGTAIGLRKDDQAHLTVINNALAEIHKNG
TYQTLEKKYFTFEVYNKKS