Protein Info for EX31_RS20715 in Rahnella sp. WP5

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 414 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details amino acids 28 to 29 (2 residues), see Phobius details transmembrane" amino acids 27 to 27 (1 residues), see Phobius details amino acids 49 to 71 (23 residues), see Phobius details amino acids 80 to 100 (21 residues), see Phobius details amino acids 106 to 126 (21 residues), see Phobius details amino acids 138 to 158 (21 residues), see Phobius details amino acids 165 to 185 (21 residues), see Phobius details amino acids 209 to 232 (24 residues), see Phobius details amino acids 248 to 267 (20 residues), see Phobius details amino acids 274 to 291 (18 residues), see Phobius details amino acids 298 to 322 (25 residues), see Phobius details amino acids 334 to 355 (22 residues), see Phobius details amino acids 361 to 381 (21 residues), see Phobius details PF07690: MFS_1" amino acids 19 to 261 (243 residues), 113.1 bits, see alignment E=1.5e-36 amino acids 248 to 383 (136 residues), 47.7 bits, see alignment E=1.1e-16

Best Hits

KEGG orthology group: None (inferred from 99% identity to rah:Rahaq_0999)

Predicted SEED Role

"Major facilitator family transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (414 amino acids)

>EX31_RS20715 MFS transporter (Rahnella sp. WP5)
MNSPALKSPLPLSALLAMALTGFIAIMTETLPAGLLPQIAADLNVSPAMAGQLVTLYAAG
SLMAVIPLAALTRGWNRRTALLTAIFGFLIFNTLTTFSTNYVLTLFARWVAGAAAGLAWG
LLAGYTRRMVPVHQQGRALSVAMVGTPLALSVGVPLGTWMGSALGWRMAFGVMSAITLLL
IVWVVKKVPDYPGQAAGERQPLRQVMMMPGVRSILMVILLWMLAHNLLYTYIVPFLRLSG
LDARADQILLVFGLGALAGIGITGMLVDKHLRRTLLVSLIAFALLSLVLALSRFSPLTVT
LCVALWGLTFGGAATLLQTAIADATGEHADMAQSMVVVAWNLAIASGGVTGGILLETAGI
AVFPWAMQLLIVAGLIIAVCARKNGFRPGARHEEIALMPEEQKRDQSFESGEKV