Protein Info for EX31_RS19700 in Rahnella sp. WP5

Annotation: phosphohistidine phosphatase SixA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00249: phosphohistidine phosphatase SixA
  • amino acids 1 to 155 (155 residues), 161.1 bits, E=9e-52
• PF00300: His_Phos_1
  • amino acids 3 to 70 (68 residues), 25.1 bits, E=6.3e-10

Best Hits

Swiss-Prot: 66% identical to SIXA_ECOLI: Phosphohistidine phosphatase SixA (sixA) from Escherichia coli (strain K12)

KEGG orthology group: K08296, phosphohistidine phosphatase [EC: 3.1.3.-] (inferred from 100% identity to rah:Rahaq_1208)

Predicted SEED Role

"Phosphohistidine phosphatase SixA"

KEGG Metabolic Maps

• Aminosugars metabolism
• Ascorbate and aldarate metabolism
• Ether lipid metabolism
• Fructose and mannose metabolism
• Lipopolysaccharide biosynthesis
• Nicotinate and nicotinamide metabolism
• Riboflavin metabolism
• Sphingolipid metabolism
• Thiamine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.-

Use Curated BLAST to search for 3.1.3.-

Protein Sequence (162 amino acids)

>EX31_RS19700 phosphohistidine phosphatase SixA (Rahnella sp. WP5)
MQVVIMRHGDAVLEAASDSVRPLSECGCDESVHMAAWLNGRGVKIDRVLVSPYLRAQQTL
EKVRQCLALPENVEIDILKELTPGGDPAVVASELQHLALTGVSAVLVVSHLPLVGYLVAE
LCPGVCPPMFATSAMASVELNGETGQGTFDWQFSPCQVMAKV