Protein Info for EX31_RS18135 in Rahnella sp. WP5

Annotation: asparagine--tRNA ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 466 TIGR00457: asparagine--tRNA ligase" amino acids 5 to 466 (462 residues), 698.8 bits, see alignment E=1.6e-214 PF01336: tRNA_anti-codon" amino acids 20 to 99 (80 residues), 47.4 bits, see alignment E=1.5e-16 PF00152: tRNA-synt_2" amino acids 124 to 460 (337 residues), 227.6 bits, see alignment E=2.2e-71

Best Hits

Swiss-Prot: 90% identical to SYN_PECAS: Asparagine--tRNA ligase (asnS) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K01893, asparaginyl-tRNA synthetase [EC: 6.1.1.22] (inferred from 100% identity to rah:Rahaq_1531)

MetaCyc: 88% identical to asparagine--tRNA ligase (Escherichia coli K-12 substr. MG1655)
Asparagine--tRNA ligase. [EC: 6.1.1.22]

Predicted SEED Role

"Asparaginyl-tRNA synthetase (EC 6.1.1.22)" in subsystem tRNA aminoacylation, Asp and Asn (EC 6.1.1.22)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (466 amino acids)

>EX31_RS18135 asparagine--tRNA ligase (Rahnella sp. WP5)
MSVVPVVDVLQGRAAVDSEVTVRGWVRTRRDSKAGISFVAVYDGSCFNPLQAVINNSLPN
YQEDVLRLTTGCSVEVTGIVVASPGEGQSFELQATTVNVVGWVDDPDTYPMAAKRHSIEY
LREVAHLRPRTNLIGAVARVRNTLSQAIHRFYHENGYFWVSTPLITASDTEGAGEMFRVS
TLDLQNLPRTDKGEIDFSEDFFGKEAFLTVSGQLNGETYACALSKVYTFGPTFRAENSNT
SRHLAEFWMVEPEVAFATLDDIAALAENMLKYVFKAVLDERADDMAFFADRVDKDAVARL
ERFVTSDFAQVDYTDAVEILMNCDQKFENPVSWGVDLSSEHERYLAEQHFKAPVVVKNYP
KDIKAFYMRMNDDGKTVAAMDVLAPGIGEIIGGSQREERLDVLDARMAEMGLNKEDYWWY
RDLRRYGTVPHSGFGLGFERLVAYVTGVQNVRDVIPFPRTPRSATF