Protein Info for EX31_RS17005 in Rahnella sp. WP5
Annotation: carbohydrate ABC transporter permease
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 35% identical to MALG_THELN: Trehalose/maltose transport system permease protein MalG (malG) from Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C)
KEGG orthology group: K02026, multiple sugar transport system permease protein (inferred from 100% identity to rah:Rahaq_2127)MetaCyc: 34% identical to ABC-type 3-(6-sulfo-alpha-D-quinovosyl)-sn-glycerol transporter permease subunit (Agrobacterium fabrum)
7.5.2.M1 [EC: 7.5.2.M1]
Predicted SEED Role
"Maltose/maltodextrin ABC transporter, permease protein MalG" in subsystem Maltose and Maltodextrin Utilization
Isozymes
No predicted isozymesUse Curated BLAST to search for 7.5.2.M1
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (280 amino acids)
>EX31_RS17005 carbohydrate ABC transporter permease (Rahnella sp. WP5) MNALSFNAWLRKGGHRLGILFYLVFALFPIYWLIKISVTPDKLLYSEGVRMWPGEMTLTH FQRVFTESQFPLYFFNSLIVSFGTAFLTTIIAAGAGFAFSRFSFRGKTVMAALLLFTQMF PLVMILAPIYKVMAPLGLTNSLLGLVLIYTAFNVPFATFLMQSFFDSIPKDLEESAMLEG CSRFMALRKVIIPLTLPGMAATLGFVFTAAWSELLFSLMLINKNEVMTFPVGLLSFVSKF AVSWGDMMAAAVLALIPACLFFAFIQRYLVQGLTAGAVKG