Protein Info for EX31_RS16500 in Rahnella sp. WP5

Annotation: ATP-binding cassette domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 577 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 44 to 64 (21 residues), see Phobius details amino acids 86 to 110 (25 residues), see Phobius details amino acids 164 to 185 (22 residues), see Phobius details amino acids 205 to 225 (21 residues), see Phobius details amino acids 294 to 314 (21 residues), see Phobius details PF05992: SbmA_BacA" amino acids 41 to 364 (324 residues), 92.6 bits, see alignment E=5e-30 PF06472: ABC_membrane_2" amino acids 44 to 297 (254 residues), 154.6 bits, see alignment E=5.4e-49 PF00005: ABC_tran" amino acids 397 to 529 (133 residues), 71.9 bits, see alignment E=1.3e-23

Best Hits

KEGG orthology group: K02471, putative ATP-binding cassette transporter (inferred from 55% identity to dda:Dd703_3329)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (577 amino acids)

>EX31_RS16500 ATP-binding cassette domain-containing protein (Rahnella sp. WP5)
MAIALFSDASGATTLTLNAILFMQSLKQFYRLIAPYWLHPREWFSWLLLLMLVSLTLGVV
WISVQYNNWSRAFYDALTDYFQHASVTGLALSYAVYTALFVVFIISTNWLKKLLIIRWRQ
KMTLRFQSAWLRQNNHYRLSLNIEPDNPDQRIAEDIRLLIEQSLGLFLSLLKNTTGLFSF
IFILWQLSDTLSITVFGHTITLHGYLVWVALGYATISSALAHWIGRPLHQLNMDKQKAEA
DYRAGLLRIRENTEQIAFYGGERVELRRMHHYFLAIVHNWQRLMKREFRLDTFTTTYFRL
SLMIPIFAVLPLYIAKKISLGGVMQARAAFGYVLDAFGWFIDSYRQIVAWSATVERLWVF
EQNLKEIPAKAICSRQPGGLICQELVARHTTGTPLFKPVNLHLHEGESIAITGASGCGKT
TFFRILSGLWPYSSGHWILPAGKTLFVPQKPYLSCDPLKHIASYPGLANISDEQIKMSLE
KVGLGHLSSQIDQTKLWQRVLSGGEQQRLSFARILINRPKLICLDESTSHLDDRTALHLM
KLIRRELPESIVLFISHQQSIIKSFTKQLEIELHEGK