Protein Info for EX31_RS14590 in Rahnella sp. WP5

Annotation: transcription/translation regulatory transformer protein RfaH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02357: NusG
  • amino acids 20 to 113 (94 residues), 74.1 bits, E=5.3e-25
• TIGR01955: transcription elongation factor/antiterminator RfaH
  • amino acids 21 to 176 (156 residues), 206.6 bits, E=1e-65

Best Hits

Swiss-Prot: 70% identical to RFAH_ECOL5: Transcription antitermination protein RfaH (rfaH) from Escherichia coli O6:K15:H31 (strain 536 / UPEC)

KEGG orthology group: K05785, transcriptional antiterminator RfaH (inferred from 100% identity to rah:Rahaq_4154)

Predicted SEED Role

"Transcriptional activator RfaH" in subsystem Transcription factors bacterial

Protein Sequence (179 amino acids)

>EX31_RS14590 transcription/translation regulatory transformer protein RfaH (Rahnella sp. WP5)
MSGFWYAAPLNAFMWETMESWYLLYCKRGQLLRAKEHLERQNVNCLTPMITLEKLVRGRR
TAVSEPLFPNYMFIEFDPERIHTTTINATRGVSHFIRFGAKLATVQPDVIKQLMEPPTIE
IRDPDTPYEGDQVVITDGIFAGIEAIYTEPDGEARSLLMLNLINQPVRQSIENTHFQKI