Protein Info for EX31_RS13305 in Rahnella sp. WP5

Annotation: ABC transporter ATP-binding protein/permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 584 transmembrane" amino acids 33 to 52 (20 residues), see Phobius details amino acids 77 to 97 (21 residues), see Phobius details amino acids 151 to 172 (22 residues), see Phobius details amino acids 192 to 212 (21 residues), see Phobius details amino acids 281 to 300 (20 residues), see Phobius details amino acids 313 to 320 (8 residues), see Phobius details PF06472: ABC_membrane_2" amino acids 25 to 301 (277 residues), 199.5 bits, see alignment E=1.1e-62 PF05992: SbmA_BacA" amino acids 29 to 351 (323 residues), 132.6 bits, see alignment E=3.3e-42 PF00005: ABC_tran" amino acids 389 to 524 (136 residues), 75.2 bits, see alignment E=1.2e-24

Best Hits

KEGG orthology group: K02471, putative ATP-binding cassette transporter (inferred from 100% identity to rah:Rahaq_0812)

Predicted SEED Role

"ABC transporter ATP-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (584 amino acids)

>EX31_RS13305 ABC transporter ATP-binding protein/permease (Rahnella sp. WP5)
MAIMTKKPGKSAQWGAVWQLIKPYWRSEEKWRAWSMLTTIIILSLAGVYLSVQFNEWNRV
FYDALQNRNYPVFKAQLWKFTWLALLFIVIAIYRVYLTQGLQMSWRRWMTEEYMEKWLTN
HAYYYTEYQHQVDNPDQRISDDLNALTSGTLSLVLGLLSSVVTLFSFVFILWSISGPLNF
MLAGHHVEIPGYMLWFALLYAAIGSFIIWYIGKPLVRLGFNQEWFEANFRFGLIRIRENS
DAIALYHGEKNEHDQLTGKFESIKTNWWSIMRVTRRLNVASNFYAQFANIFPILVASPRY
FSGAIQMGALMQIASAFGQVQGALSWFIDAFTDLANWKATVNRLAGFNAAIDQVNAQPRG
ISVGKSTEHALQLDKLTLNLPNGNPLFCNISAAMQPGERVLIAGPSGCGKSTLLRAIAGI
WPYGSGNIALAEGKRYLFLPQRSYIPIGTLRDALSYPDASREYTDEQLQQVLTQCRLSHL
AAVEILDDYANWSQRLSPGEQQRLSFARALLIKPDTLFLDEATSALDDETEQQVYALLLS
ELPETSVISVAHRNSVAKYHQHCWRFKNQENGPCGFTSTALLPE