Protein Info for EX31_RS06960 in Rahnella sp. WP5

Annotation: DNA replication terminus site-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 PF05472: Ter" amino acids 9 to 306 (298 residues), 439.1 bits, see alignment E=3.4e-136 TIGR02648: DNA replication terminus site-binding protein" amino acids 10 to 308 (299 residues), 496.7 bits, see alignment E=1.1e-153

Best Hits

Swiss-Prot: 65% identical to TUS_YERP3: DNA replication terminus site-binding protein (tus) from Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)

KEGG orthology group: K10748, DNA replication terminus site-binding protein (inferred from 100% identity to rah:Rahaq_2204)

Predicted SEED Role

"DNA replication terminus site-binding protein" in subsystem DNA-replication

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (311 amino acids)

>EX31_RS06960 DNA replication terminus site-binding protein (Rahnella sp. WP5)
MADYDLIARMNGCFNELEMALQDLGNFLGQLELLQARVFTLPEVVKGEEHNPADKITVTP
HTGETAQQLALQHFQRLFIHHNNENVSSKSAVRLPGVLCYAVDAAEHQSALLLIEEVNKL
KAELEHIVTVESGLAREQRFEFVHTHLRGLITLNAYRSVTYLNDPDSVRFGWANKHIIKN
VTRDEVLAQLEKSLHAGRAVSPYTREQWMENINREMIDVKRLPEHAALKFKRPVKVQPIA
RVWYRNNQKQVQHPCPLPLIALCLRSPMMQLPKLGELHDYDVSSVKHKYKPQSQPLSLLI
KRLHLYTDHPL