Protein Info for EX31_RS05815 in Rahnella sp. WP5

Annotation: LysE family translocator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 202 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 40 to 63 (24 residues), see Phobius details amino acids 69 to 88 (20 residues), see Phobius details amino acids 108 to 129 (22 residues), see Phobius details amino acids 135 to 160 (26 residues), see Phobius details amino acids 176 to 194 (19 residues), see Phobius details PF01810: LysE" amino acids 12 to 194 (183 residues), 51.8 bits, see alignment E=3.8e-18

Best Hits

KEGG orthology group: None (inferred from 99% identity to rah:Rahaq_0037)

Predicted SEED Role

"Transporter, LysE family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (202 amino acids)

>EX31_RS05815 LysE family translocator (Rahnella sp. WP5)
MIDTAFVSYVTVMSITPGPNNLLLAASGVNFGLRRSVPMMLGITLGCVVQCALMTSMLAI
LLSWMTVVRLPMAAVGCAYLFWLSWKIYRSGSPKEGAKQQPMNMINGALFQAVNPKAWLM
ATNVAILFTPPDGNMLHHTLLICIGFALINLPCILVWVVMGDRLRQALRVEWKLKMFNTI
MGGMMALTALWLLVGEVRHAMI