Protein Info for EX31_RS05440 in Rahnella sp. WP5

Annotation: insulinase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 504 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF00675: Peptidase_M16" amino acids 52 to 170 (119 residues), 41.3 bits, see alignment E=1.6e-14 PF05193: Peptidase_M16_C" amino acids 201 to 385 (185 residues), 74.8 bits, see alignment E=8.3e-25

Best Hits

KEGG orthology group: None (inferred from 100% identity to rah:Rahaq_0111)

Predicted SEED Role

"Protein YhjJ, putative peptidase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (504 amino acids)

>EX31_RS05440 insulinase family protein (Rahnella sp. WP5)
MQGTKIRLLIGGLLLAAAASHVQAEALQPDPAWQQGKLDNGFTWQLLTTPQRPSDRIELR
LVVRTGSLAESAQQTGYAHFLPRLALMHSEGFSTAQLQSLWQQSINPQRPLPPAVSSYDF
TMYNLSLPNNRPELLKDALNWLANTAGKVSVTPALVSAARQESQDPVGSLPQNTQDAWWR
ARMAGSTLVGHNPNHLPTKPVNIDALIKFYHQWYTPDAMTLFVVGNVDSRGLSEQINRTF
SSLKGSRQTPQTLPTLSEVTTKSMTVMDENLTQDRVSLMWDNAWQPIQDSQALAAYWRSD
LAREALFWHLQQQLKSAFETKKDTPAPGPGLGFDCNVQYQRAQCAIRIEAPQAKLTELFK
RLSEELLAVRDKGISQAEFDALIAQKNDQLSKLFATYARTDTDVLMSQRLRSQQNGVVDI
APEQYQQLRQQFLSTLTLPVLNQELKQQLSRAPALLVAQPKGEPEVNAAELRAVYDKIMA
PVETAPAVDAPAGDVPAASAATAQ