Protein Info for EX31_RS04555 in Rahnella sp. WP5

Annotation: (S)-ureidoglycine aminohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03214: putative allantoin catabolism protein
  • amino acids 3 to 263 (261 residues), 349.9 bits, E=4.4e-109
• PF05899: Cupin_3
  • amino acids 83 to 119 (37 residues), 26.6 bits, 4e-10

Best Hits

Swiss-Prot: 68% identical to ALLE_ECOLI: (S)-ureidoglycine aminohydrolase (allE) from Escherichia coli (strain K12)

KEGG orthology group: K14977, ureidoglycine aminohydrolase [EC: 3.5.3.-] (inferred from 99% identity to rah:Rahaq_0300)

MetaCyc: 68% identical to (S)-ureidoglycine aminohydrolase (Escherichia coli K-12 substr. MG1655)
URUR-RXN [EC: 3.5.3.26]

Predicted SEED Role

"Ureidoglycine aminohydrolase"

MetaCyc Pathways

• allantoin degradation IV (anaerobic) (8/9 steps found)
• allantoin degradation to glyoxylate II (5/5 steps found)
• allantoin degradation to glyoxylate III (5/5 steps found)
• allantoin degradation to ureidoglycolate II (ammonia producing) (4/4 steps found)
• superpathway of allantoin degradation in plants (6/8 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.3.- or 3.5.3.26

Protein Sequence (263 amino acids)

>EX31_RS04555 (S)-ureidoglycine aminohydrolase (Rahnella sp. WP5)
MGYINQKTGYINDLLSNRSIIKRGNYALIEPDGLVKNTLPGFERCEITILATPKLGATFV
DYLVNMLEGGKNLAGFGGDAHIETFVYVIDGNITANAEGQDYRLESGGYLYCPPGVSMTL
VNANGGQNSRLFLYKKRYTPVSGFQPHVVSNNVHQLEKIHYEGMSDVIVQDLLPADLGFD
MNIHILTFAPGACHGYVETHVQEHGALILSGEGMYNLDNHWIPVKKNDYIFMGAYCPQAC
YAVGRDEPLSYIYSKDCNRDVEL