Protein Info for EX31_RS03885 in Rahnella sp. WP5

Annotation: transcriptional activator NhaR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 PF00126: HTH_1" amino acids 7 to 65 (59 residues), 60.7 bits, see alignment E=1.1e-20 PF03466: LysR_substrate" amino acids 95 to 284 (190 residues), 43.9 bits, see alignment E=1.8e-15

Best Hits

Swiss-Prot: 79% identical to NHAR_SHIFL: Transcriptional activator protein NhaR (nhaR) from Shigella flexneri

KEGG orthology group: K03717, LysR family transcriptional regulator, transcriptional activator of nhaA (inferred from 99% identity to rah:Rahaq_3787)

Predicted SEED Role

"Transcriptional activator NhaR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (295 amino acids)

>EX31_RS03885 transcriptional activator NhaR (Rahnella sp. WP5)
MPHINYNHLYYFWHVCKSGSVVGAAEVLHLTPQTITGQIKSLEERLDGKLFKRQGRGLVP
SELGQLVYRYADKMFTLSQEMLDIVNYRKEASLLFDVGVADALSKRLVSRVLEAAVPDNA
QIHLRCFESTHEMLLEQLSQHKLDMILSDCPVDSTQQAGLFSVKLGESPISFFCCNPPAG
MNFPACLERRSLLIPGRRSMLGRKLLNWFNTQGLKVNILGEFDDAALMKAFGMNNNAIFV
APAIYSSTEFQDEKIEEVGRVEGIMEEYYVIFAERMIQHPSVQRICHTDFSALFE