Protein Info for EX31_RS03375 in Rahnella sp. WP5

Annotation: polyamine aminopropyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 PF17284: Spermine_synt_N" amino acids 10 to 61 (52 residues), 61.4 bits, see alignment 9.2e-21 TIGR00417: spermidine synthase" amino acids 11 to 282 (272 residues), 391.2 bits, see alignment E=1.1e-121 PF01564: Spermine_synth" amino acids 64 to 245 (182 residues), 240.4 bits, see alignment E=1.7e-75

Best Hits

Swiss-Prot: 85% identical to SPEE_SERP5: Polyamine aminopropyltransferase (speE) from Serratia proteamaculans (strain 568)

KEGG orthology group: K00797, spermidine synthase [EC: 2.5.1.16] (inferred from 100% identity to rah:Rahaq_3687)

MetaCyc: 81% identical to spermidine synthase (Escherichia coli K-12 substr. MG1655)
Spermidine synthase. [EC: 2.5.1.16]; 2.5.1.- [EC: 2.5.1.16]

Predicted SEED Role

"Spermidine synthase (EC 2.5.1.16)" in subsystem Polyamine Metabolism (EC 2.5.1.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (291 amino acids)

>EX31_RS03375 polyamine aminopropyltransferase (Rahnella sp. WP5)
MSRNSSSKEIWYETLHAHFGQYFSVDKELYREKTDHQDLVIFENAALGRVMALDGVVQTT
ERDEFIYHEMLTHVPLFAHGSARKVLIIGGGDGAMLREVSRHKGVESITMVEIDAGVVEF
CRQYLPNHNAGSYDDPRFKLVIDDGVNFVNQTTETFDVIISDCTDPIGPGESLFTSAFYE
GCARCLNPGGIFVAQNGVCFLQQDEAVNSHTKLSHYFSDVSFYQAAIPTYYGGIMTFAWA
TNSPEYRQIDSKTLQARFDAADITCRYYNPAIHHGSFALPQYLLNALSAAR