Protein Info for ECOLIN_RS23530 in Escherichia coli Nissle 1917

Annotation: CidA/LrgA family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 136 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 43 to 62 (20 residues), see Phobius details amino acids 74 to 95 (22 residues), see Phobius details amino acids 101 to 122 (22 residues), see Phobius details PF03788: LrgA" amino acids 31 to 122 (92 residues), 90.1 bits, see alignment E=3.7e-30

Best Hits

Swiss-Prot: 36% identical to CIDA_BACLD: Holin-like protein CidA (cidA) from Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46)

KEGG orthology group: K06518, holin-like protein (inferred from 100% identity to eci:UTI89_C4655)

Predicted SEED Role

"Holin-like protein CidA" in subsystem Murein hydrolase regulation and cell death

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (136 amino acids)

>ECOLIN_RS23530 CidA/LrgA family protein (Escherichia coli Nissle 1917)
MPVALRRITPAVVQSIQVFFQVVLYAGLFIFAQYLVSWLHLPLPANLVGMILMLALIVCR
ILPLQWVRAGARWLLAEMLLFFVPAVVAVVNYAQLLLVDGWRIFAVIALSTVMVLGTTAW
VVEKVYRYEMRRLNRG