Protein Info for ECOLIN_RS20455 in Escherichia coli Nissle 1917

Annotation: DUF4862 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 PF16154: DUF4862" amino acids 9 to 294 (286 residues), 317.7 bits, see alignment E=4.1e-99

Best Hits

Swiss-Prot: 77% identical to Y3670_SALTY: Uncharacterized protein STM3670 (STM3670) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 100% identity to ecg:E2348C_3829)

Predicted SEED Role

"Putative chemotaxis protein, resembles cheA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (306 amino acids)

>ECOLIN_RS20455 DUF4862 family protein (Escherichia coli Nissle 1917)
MKTNNAGYIIGAYPCAPSFHQRSEEEEKDFWRQLSETPDILGLEQPCLENFHPLGDQWLL
RHTPESWKFVVTAVMETMRRRSENSGFGLASSDEEQRQACVAYYRHLFNKINSLQANKVL
ALELQAAPLATNPNVMQATDAFARSLKEIASWDWPCKLVLEHCDAMTSSSPRKGFLPLEN
VLEVITDYDISICINWARSAIEGRNTTLPLTHTQMAKQAGKLGALMFSGTTLNGAYGEWQ
DLHAPFAPFCAESLMTTDHVRELFNVAESSTLHFAGIKLLEINATADVHHRIEILRNGIH
SLNESR