Protein Info for ECOLIN_RS15085 in Escherichia coli Nissle 1917

Annotation: PTS glucitol/sorbitol transporter subunit IIA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00849: PTS system, glucitol/sorbitol-specific IIA component
  • amino acids 1 to 123 (123 residues), 196.5 bits, E=5.1e-63
• PF03829: PTSIIA_gutA
  • amino acids 4 to 115 (112 residues), 129.5 bits, E=2.9e-42

Best Hits

Swiss-Prot: 98% identical to PTHA_SHIFL: PTS system glucitol/sorbitol-specific EIIA component (srlB) from Shigella flexneri

KEGG orthology group: K02781, PTS system, glucitol/sorbitol-specific IIA component [EC: 2.7.1.69] (inferred from 98% identity to eco:b2704)

MetaCyc: 98% identical to sorbitol-specific PTS enzyme IIA component (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-169 [EC: 2.7.1.198]; TRANS-RXN-156 [EC: 2.7.1.198, 2.7.1.197]

Predicted SEED Role

No annotation

KEGG Metabolic Maps

• Aminosugars metabolism
• Ascorbate and aldarate metabolism
• Fructose and mannose metabolism
• Galactose metabolism
• Glycolysis / Gluconeogenesis
• Nucleotide sugars metabolism
• Starch and sucrose metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.197 or 2.7.1.198 or 2.7.1.69

Protein Sequence (123 amino acids)

>ECOLIN_RS15085 PTS glucitol/sorbitol transporter subunit IIA (Escherichia coli Nissle 1917)
MTVIYQTTITRIGASATDALSDQMLITFREGAPADLEEYCFIHCHGELKGALHPGLQFSL
GRHRYPVTAVGSVAEDNLRELGHVTLRFDGLSEAEFPGTVHVAGPVPDDIAPGSVLKFES
VKE