Protein Info for ECOLIN_RS14810 in Escherichia coli Nissle 1917

Annotation: phage tail tube protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 190 PF16461: Phage_TTP_12" amino acids 18 to 152 (135 residues), 213.4 bits, see alignment E=8.8e-68 PF02368: Big_2" amino acids 139 to 190 (52 residues), 24.4 bits, see alignment E=2.3e-09

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (190 amino acids)

>ECOLIN_RS14810 phage tail tube protein (Escherichia coli Nissle 1917)
MPTPNPLAPVKGAGTTLWVYNGSGDPYANPLSDNDWSRLAKIKDLTPGELTAESYDDSYL
DDEDADWTATGQGQKSAGDTSFTLAWMPGEQGQQALLAWFNEGDTRAYKIRFPNGTVDVF
RGWVSSIGKAVTAKEVITRTVKVTNVGRPSMAEDRSTVTADKTKATVSVSGMTITVNGVA
AGKVNIPVVS