Protein Info for Dsui_3537 in Dechlorosoma suillum PS

Annotation: DNA polymerase III, chi subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 143 PF04364: DNA_pol3_chi" amino acids 1 to 135 (135 residues), 125.4 bits, see alignment E=9.1e-41

Best Hits

KEGG orthology group: K02339, DNA polymerase III subunit chi [EC: 2.7.7.7] (inferred from 56% identity to dar:Daro_3083)

Predicted SEED Role

"DNA polymerase III chi subunit (EC 2.7.7.7)" in subsystem DNA-replication (EC 2.7.7.7)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QM18 at UniProt or InterPro

Protein Sequence (143 amino acids)

>Dsui_3537 DNA polymerase III, chi subunit (Dechlorosoma suillum PS)
MTRVDFYYDVPNKLAIAVKLAHKAFSQRLPLAIYTSQPPVAEQIDRLLWTQPALGFLPHC
RADAPLAAETPVLIAETPAALERLPQDELLINLDDEVPPGFARFKRLIEIVGREEEDKTP
GRARFKFYKDRGYEINRHDLSAK