Protein Info for Dsui_3533 in Dechlorosoma suillum PS

Annotation: putative membrane protein/domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 159 transmembrane" amino acids 34 to 59 (26 residues), see Phobius details amino acids 67 to 86 (20 residues), see Phobius details amino acids 116 to 137 (22 residues), see Phobius details PF06271: RDD" amino acids 25 to 150 (126 residues), 67.3 bits, see alignment E=9.2e-23

Best Hits

KEGG orthology group: None (inferred from 59% identity to app:CAP2UW1_4124)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QM14 at UniProt or InterPro

Protein Sequence (159 amino acids)

>Dsui_3533 putative membrane protein/domain protein (Dechlorosoma suillum PS)
MTSRPDSTLASGQGKPAAPDQRSPASLFRRLASMLYDTLLALAVLFLAWLLPHILLGLVG
KVMAHPALLWGHFFLVLLLYFGWLWLHGGQTLAMKTWRIRLVNANGGGIQPLQALLRYLL
AWPSLGFFGAGLVWALFDRDGQFLHDRLAGTRLVNSNHA