Protein Info for Dsui_3525 in Dechlorosoma suillum PS

Annotation: CDP-diacylglycerol--serine O-phosphatidyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 46 to 63 (18 residues), see Phobius details amino acids 84 to 103 (20 residues), see Phobius details amino acids 109 to 127 (19 residues), see Phobius details amino acids 139 to 158 (20 residues), see Phobius details amino acids 170 to 190 (21 residues), see Phobius details amino acids 202 to 220 (19 residues), see Phobius details amino acids 226 to 245 (20 residues), see Phobius details PF01066: CDP-OH_P_transf" amino acids 22 to 178 (157 residues), 72.8 bits, see alignment E=2.2e-24 TIGR00473: CDP-diacylglycerol-serine O-phosphatidyltransferase" amino acids 30 to 190 (161 residues), 108.9 bits, see alignment E=1.2e-35

Best Hits

KEGG orthology group: K00998, phosphatidylserine synthase [EC: 2.7.8.8] (inferred from 78% identity to dar:Daro_3072)

Predicted SEED Role

"CDP-diacylglycerol--serine O-phosphatidyltransferase (EC 2.7.8.8)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.8.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QM06 at UniProt or InterPro

Protein Sequence (254 amino acids)

>Dsui_3525 CDP-diacylglycerol--serine O-phosphatidyltransferase (Dechlorosoma suillum PS)
MSELKPRKVLFNPELKRRGIYVLPNLFTTAALFAGFFAIVQAMNGFYEQSAVAIFVAMVL
DGLDGRVARLTHTQSAFGAEYDSLSDMVSFGAAPSLVIYEWALRGMGKLGWIAAFIYCAG
AALRLARFNTTLEVIDKRFFQGLPSPAAAALVAGFVWLMLDNDIVGSDVRVIACILTIFA
GVSMVTNCRFYSFKDINLRKSVPFIFVGAIVLAFALVFMYPPGVLFGLFVVYALSGYALS
GLRLLRRKPASTPL