Protein Info for Dsui_3524 in Dechlorosoma suillum PS

Annotation: signal transduction histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 462 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 128 to 146 (19 residues), see Phobius details amino acids 158 to 181 (24 residues), see Phobius details PF08521: 2CSK_N" amino acids 19 to 158 (140 residues), 111.7 bits, see alignment E=6.2e-36 PF26769: HAMP_PhoQ" amino acids 185 to 229 (45 residues), 43.9 bits, see alignment 3.8e-15 PF00512: HisKA" amino acids 235 to 306 (72 residues), 52.5 bits, see alignment E=8e-18 PF02518: HATPase_c" amino acids 350 to 458 (109 residues), 90.8 bits, see alignment E=1.6e-29

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QM05 at UniProt or InterPro

Protein Sequence (462 amino acids)

>Dsui_3524 signal transduction histidine kinase (Dechlorosoma suillum PS)
MIRQPSLRRLLLIWLLPAMLALVAAGGLMAYGIALRSATWAYDRALLDTSLALSGQIHIV
SGHPVLNLPSQAQEILLTDRYDNVFYEVIGPQGESVAGHRGIPRPPQQLPEDGRIYYDGW
FHDREVRVAALFVLREGIPLLILAAETQTKRDNLVREILTSMLLPELLLVAATLGLGWLG
IRHGLKPVEDLREQLSQRSHHDLSAVSSDRVPREIGPLVEELNHLLSRLDGSLSAQRNFV
SDAAHQLRTPLAALQAQAELALRRLNGPAPAQTGELRAELERILAATRRLTHLAHQLLAL
ARAEPGGEQAMKPLDLVEVVHQCAETWHPRALERNIDLGFDLAPAPLLGHPRLLEELLSN
LIDNAIHYTPAGGSVTVRTFARDGAAVLQVDDTGPGIAPEQREKVFERFHRINGEQNPEG
CGLGLAIVREIAKQHGADVWLDEAPVLGGARLEVSFPPPPGR