Protein Info for Dsui_3523 in Dechlorosoma suillum PS

Annotation: response regulator with CheY-like receiver domain and winged-helix DNA-binding domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 236 PF00072: Response_reg" amino acids 3 to 112 (110 residues), 98.2 bits, see alignment E=3.3e-32 PF00486: Trans_reg_C" amino acids 146 to 218 (73 residues), 67.8 bits, see alignment E=7.2e-23

Best Hits

Swiss-Prot: 49% identical to QSEB_ECO57: Transcriptional regulatory protein QseB (qseB) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 70% identity to dar:Daro_1878)

Predicted SEED Role

"Two-component system response regulator QseB" in subsystem Orphan regulatory proteins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QM04 at UniProt or InterPro

Protein Sequence (236 amino acids)

>Dsui_3523 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain (Dechlorosoma suillum PS)
MRILLVEDDELLADGLVKALRQSGYVTDWTRDGKQADSWLTDQNYDLAILDLGLPGMEGS
EVLQRLRGRKLATPVLILSAREALEERVRLLDLGADDYLVKPVALSELEARARALIRRGR
TQPDPELRLGKLRLDTVGKRAWLGEEPLDLTAREWAALEFLVSRANRIVSKEQIMQSLYS
WDEDITPNAIEKFISRLRVKLETGGISIRTVRGLGYYLEKPKDEDGADAASDDPPA