Protein Info for Dsui_3522 in Dechlorosoma suillum PS

Annotation: outer membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 418 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF02321: OEP" amino acids 38 to 215 (178 residues), 37.7 bits, see alignment E=9.3e-14 amino acids 244 to 418 (175 residues), 60.3 bits, see alignment E=1.1e-20

Best Hits

KEGG orthology group: None (inferred from 55% identity to dar:Daro_1877)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QM03 at UniProt or InterPro

Protein Sequence (418 amino acids)

>Dsui_3522 outer membrane protein (Dechlorosoma suillum PS)
MSRSLLICLALLTAGSACVHAAEPLQELGLAQAEALWLAQNREVRLAREGVQAAQADSLT
AAQAPNPQFSLSTSSINPRSGIGAGSLGQKRVDSVLRLDQVIERGDKRELRQQVAGAALE
AAGQGLAEVQRQSRFQLRVAYWDLRLAQERRQVAEESGELYRRSVKAAEMRLKVGDVAGA
DVSRLRIEAGRAENEARAAQADLERARQNLAYLIGKESEAASLRATEPWPRSEGEAVTAR
RPELESRADVLAARARVKAAEAARELARAARSRDVTVGVQFEHFPPGDASPNNTYGVSLS
VPLFLRHAYEGEIARAEAELLAARTQEEQVRAQALGEVAQAESLLGAARERRQRLEDGLL
AEAERVASASEYAYGRGALGLLDLLDARRTLRAVRLDAAILRAEYAKALAAWQAVLGQ