Protein Info for Dsui_3517 in Dechlorosoma suillum PS

Annotation: putative membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 transmembrane" amino acids 28 to 51 (24 residues), see Phobius details amino acids 95 to 114 (20 residues), see Phobius details amino acids 135 to 159 (25 residues), see Phobius details amino acids 175 to 195 (21 residues), see Phobius details amino acids 206 to 224 (19 residues), see Phobius details amino acids 236 to 265 (30 residues), see Phobius details TIGR00765: YihY family inner membrane protein" amino acids 15 to 270 (256 residues), 206.2 bits, see alignment E=4.1e-65 PF03631: Virul_fac_BrkB" amino acids 22 to 271 (250 residues), 179.8 bits, see alignment E=4e-57

Best Hits

KEGG orthology group: K07058, membrane protein (inferred from 49% identity to app:CAP2UW1_4113)

Predicted SEED Role

"Ribonuclease BN (EC 3.1.-.-)" in subsystem LMPTP YfkJ cluster or tRNA processing (EC 3.1.-.-)

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QLD2 at UniProt or InterPro

Protein Sequence (276 amino acids)

>Dsui_3517 putative membrane protein (Dechlorosoma suillum PS)
MARRRYSQREGMLPEMFRRFREERFTQTAASLAYTTLLSLVPLVGLVVAVLSDLPFFPVI
LDQVNTFLVANLLPDKAGVVIAKYTLIFSQKVNRLTWLGVMVLAGTALVLMLTIERALNH
VWQVGVSRSPGRRLKLYLVIALLGPLVLGAVFGVTSYVVTASLGFFNEALWVRNALLKAL
SAVLLGGFFAFLYFAVPNVPVRLRHAIWGGAFASLAITLMQRGFEFYLAKVPSYTLIYGA
FAAVPIFLVWLYLSWLVVLLGALLAATLHRRNPPGG