Protein Info for Dsui_3514 in Dechlorosoma suillum PS

Annotation: 16S rRNA processing protein RimM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 182 TIGR02273: 16S rRNA processing protein RimM" amino acids 10 to 181 (172 residues), 158.4 bits, see alignment E=5.2e-51 PF01782: RimM" amino acids 12 to 102 (91 residues), 79.3 bits, see alignment E=3.2e-26 PF05239: PRC" amino acids 109 to 177 (69 residues), 46.2 bits, see alignment E=5.7e-16 PF24986: PRC_RimM" amino acids 114 to 181 (68 residues), 59 bits, see alignment E=4.3e-20

Best Hits

Swiss-Prot: 62% identical to RIMM_AZOSB: Ribosome maturation factor RimM (rimM) from Azoarcus sp. (strain BH72)

KEGG orthology group: K02860, 16S rRNA processing protein RimM (inferred from 62% identity to azo:azo2899)

Predicted SEED Role

"16S rRNA processing protein RimM" in subsystem Ribosome biogenesis bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QLC9 at UniProt or InterPro

Protein Sequence (182 amino acids)

>Dsui_3514 16S rRNA processing protein RimM (Dechlorosoma suillum PS)
MTATDTNPVIVLGKITVPYGIQGWVRIHPFADDPLAWAKMPEWWVATEKGDGAAEVPLAQ
WRSCKLKQCRWHGDGLVARLEGVDDRNAAEALQGFLVGAPREAMPATSENEFYWTDLIGL
DVVNTRDEKLGQVVGLIETGANDVLRVAAEDGEERLLPFVAAVVLAVEQADHRIRVEWEK
DW