Protein Info for Dsui_3511 in Dechlorosoma suillum PS

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 265 PF02649: GCHY-1" amino acids 8 to 257 (250 residues), 333.4 bits, see alignment E=5.1e-104

Best Hits

Swiss-Prot: 78% identical to GCH42_DECAR: GTP cyclohydrolase FolE2 2 (folE2-2) from Dechloromonas aromatica (strain RCB)

KEGG orthology group: K09007, hypothetical protein (inferred from 78% identity to dar:Daro_3062)

Predicted SEED Role

"GTP cyclohydrolase I (EC 3.5.4.16) type 2" in subsystem Folate Biosynthesis or Queuosine-Archaeosine Biosynthesis (EC 3.5.4.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.4.16

Use Curated BLAST to search for 3.5.4.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QLC6 at UniProt or InterPro

Protein Sequence (265 amino acids)

>Dsui_3511 hypothetical protein (Dechlorosoma suillum PS)
MTTSQTPIPDVQNSEDTRRIAINKVGIRAIRHPVKIRDKGGDVRHTVASFNMYVGLPHNF
KGTHMSRFVEILNSHEREISVESFPTMLQAMAARLEARSGHIEMSFPYFIAKTAPVSGVP
SLLDYDVTLIGEIADGRITSTVRVVVPVTSLCPCSKEISNYGAHNQRSHVTVTARLNAFL
WIEDLVQMVEAQASCELFGLLKRPDEKWVTERAYDNPKFVEDMVRDVAARLNEDPRIDHY
VVESENFESIHNHSAYALIEKDKRA