Protein Info for Dsui_3510 in Dechlorosoma suillum PS

Annotation: 1-deoxy-D-xylulose-5-phosphate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13292: DXP_synthase_N
  • amino acids 8 to 279 (272 residues), 415.6 bits, E=2.2e-128
• TIGR00204: 1-deoxy-D-xylulose-5-phosphate synthase
  • amino acids 10 to 616 (607 residues), 877.4 bits, E=2.9e-268
• PF02775: TPP_enzyme_C
  • amino acids 112 to 179 (68 residues), 23.7 bits, E=9.5e-09
• PF00676: E1_dh
  • amino acids 120 to 185 (66 residues), 35.1 bits, E=1.8e-12
• PF02779: Transket_pyr
  • amino acids 315 to 475 (161 residues), 161.9 bits, E=3.1e-51
• PF02780: Transketolase_C
  • amino acids 492 to 608 (117 residues), 94.4 bits, E=1.3e-30

Best Hits

Swiss-Prot: 78% identical to DXS_DECAR: 1-deoxy-D-xylulose-5-phosphate synthase (dxs) from Dechloromonas aromatica (strain RCB)

KEGG orthology group: K01662, 1-deoxy-D-xylulose-5-phosphate synthase [EC: 2.2.1.7] (inferred from 82% identity to app:CAP2UW1_4105)

MetaCyc: 59% identical to 1-deoxy-D-xylulose-5-phosphate synthase (Escherichia coli K-12 substr. MG1655)
1-deoxy-D-xylulose-5-phosphate synthase. [EC: 2.2.1.7]

Predicted SEED Role

"1-deoxy-D-xylulose 5-phosphate synthase (EC 2.2.1.7)" in subsystem Isoprenoid Biosynthesis or Pyridoxin (Vitamin B6) Biosynthesis or Thiamin biosynthesis (EC 2.2.1.7)

MetaCyc Pathways

• methylerythritol phosphate pathway II (8/9 steps found)
• superpathway of geranylgeranyl diphosphate biosynthesis II (via MEP) (10/12 steps found)
• pyridoxal 5'-phosphate biosynthesis I (6/7 steps found)
• taxadiene biosynthesis (engineered) (10/13 steps found)
• methylerythritol phosphate pathway I (7/9 steps found)
• superpathway of thiamine diphosphate biosynthesis II (8/11 steps found)
• isoprene biosynthesis I (7/10 steps found)
• superpathway of thiamine diphosphate biosynthesis I (7/10 steps found)
• thiazole component of thiamine diphosphate biosynthesis II (4/7 steps found)
• thiazole component of thiamine diphosphate biosynthesis I (3/6 steps found)
• superpathway of pyridoxal 5'-phosphate biosynthesis and salvage (7/12 steps found)
• superpathway of ergosterol biosynthesis II (11/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Terpenoid biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.2.1.7

Sequence Analysis Tools

See G8QLC5 at UniProt or InterPro

Protein Sequence (618 amino acids)

>Dsui_3510 1-deoxy-D-xylulose-5-phosphate synthase (Dechlorosoma suillum PS)
MMTATPLLDTIDSPAQLRRLDKRQLPQLAEELRTFIVESVSRTGGHLSSNLGTVELTIAL
HYVFDTPEDRLVWDVGHQTYPHKILTGRRAGMAKLRMHGGLSGFPKRCESAYDTFGVGHS
STSISAALGMALAAKQKGENRKAVAIIGDGAMSAGMAFEALNNAGVADANMLVILNDNDM
SISPPVGALNKYLARLLSGGLYSAARRAGEKVLGVAPPLLELAKRAEEHVKGMLTPGTLF
EELGFNYIGPIDGHDLDALVPTLQNLKGLKGPQFLHVITKKGQGYKLAEANPVLYHGVSK
FQPEVGIQSGKGGGKLTYTQVFSDWLCDMAAAEPRLVGITPAMGEGSGLVRFAELYPERY
FDVGIAEQHAVTFAAGLACEGLKPVVAIYSTFLQRGYDQLVHDVALQNLPVVFAIDRGGL
VGADGATHHGAFDLSFMTCIPNLVIMAPADEDECRKMLTTAMGIDGPSAVRYPRGGGSGV
TPETALTALPVGKGEIRRQGKGVALLAFGSMVQAALGAGDALDASVANMRFVKPLDRELL
AELARNHELLVSVEENALIGGAGSEVARALEEMGLTVPLLRLGLPDHFIDHGDQNLLLAE
LGLDVDGIVRQVRQRLAA