Protein Info for Dsui_3502 in Dechlorosoma suillum PS

Annotation: iron-sulfur cluster binding protein, putative

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 TIGR00276: epoxyqueuosine reductase" amino acids 29 to 361 (333 residues), 460.5 bits, see alignment E=1.5e-142 PF08331: QueG_DUF1730" amino acids 77 to 155 (79 residues), 86 bits, see alignment E=1.4e-28 PF13484: Fer4_16" amino acids 206 to 270 (65 residues), 80.4 bits, see alignment E=1.4e-26

Best Hits

Swiss-Prot: 57% identical to QUEG_PSEAE: Epoxyqueuosine reductase (queG) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 65% identity to tmz:Tmz1t_1785)

MetaCyc: 55% identical to epoxyqueuosine reductase (Escherichia coli K-12 substr. MG1655)
RXN-12104 [EC: 1.17.99.6]

Predicted SEED Role

"Epoxyqueuosine (oQ) reductase QueG"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.17.99.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QLB7 at UniProt or InterPro

Protein Sequence (372 amino acids)

>Dsui_3502 iron-sulfur cluster binding protein, putative (Dechlorosoma suillum PS)
MQQTEAGTPARPAAAGEAAPDWPGLAARLKAWGRELGFAEVAIGRAEIGEAGQRLLAWLE
QGHHGSMDYMAKHAPLRLDPGQLVPGVQTVISVRLPYLPRGAEPEQVLADPALGYVSRYA
LGRDYHKVIRNRLQKLADRLQAEIGDFGYRVFSDSAPVMEVEFARKSGLGWRGKHTLLLT
REGSWHFLGEIYTDLPLPADAEVSDHCGACTRCIDACPTRAIVAPYQVDARRCISYLTIE
LDGAMPEELRPLLGNRIYGCDDCQLCCPWNRFGQLGDAEFTTRQGLDAARLSALMAWSEA
DFLERMAGSPIRRIGIERWRRNIAVALGNGPATEEARAALAARREDDSAVVREHVAWAER
QLEKKTPPTGGV