Protein Info for Dsui_3501 in Dechlorosoma suillum PS

Annotation: ATPase, YjeE family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 175 TIGR00150: tRNA threonylcarbamoyl adenosine modification protein YjeE" amino acids 21 to 147 (127 residues), 134.9 bits, see alignment E=7.9e-44 PF02367: TsaE" amino acids 21 to 143 (123 residues), 132.6 bits, see alignment E=4.2e-43

Best Hits

KEGG orthology group: K06925, UPF0079 ATP-binding protein (inferred from 56% identity to nmu:Nmul_A2531)

Predicted SEED Role

"TsaE protein, required for threonylcarbamoyladenosine t(6)A37 formation in tRNA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QLB6 at UniProt or InterPro

Protein Sequence (175 amino acids)

>Dsui_3501 ATPase, YjeE family (Dechlorosoma suillum PS)
MPDHSESAAQSLNPGQSLLLANEAATQALGTALTQAAGPGLVIYLEGDLGAGKTTLVRAL
LRALGHTGPVKSPTYALVEVYKLSSLYLYHFDFYRFESPEEFVDAGLDDYFRQGALCLVE
WPDKAAGFVPPPDLVLAFRFRDDDGRDLLLQPHSPGGEQCVNALMSRLSSAAGPC