Protein Info for Dsui_3497 in Dechlorosoma suillum PS

Annotation: lipoprotein signal peptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 166 signal peptide" amino acids 1 to 11 (11 residues), see Phobius details amino acids 23 to 24 (2 residues), see Phobius details amino acids 27 to 30 (4 residues), see Phobius details transmembrane" amino acids 12 to 22 (11 residues), see Phobius details amino acids 25 to 26 (2 residues), see Phobius details amino acids 66 to 84 (19 residues), see Phobius details amino acids 92 to 109 (18 residues), see Phobius details amino acids 129 to 149 (21 residues), see Phobius details TIGR00077: signal peptidase II" amino acids 9 to 152 (144 residues), 144.3 bits, see alignment E=1.6e-46 PF01252: Peptidase_A8" amino acids 12 to 151 (140 residues), 147.6 bits, see alignment E=1.4e-47

Best Hits

Swiss-Prot: 54% identical to LSPA_POLNS: Lipoprotein signal peptidase (lspA) from Polynucleobacter necessarius subsp. necessarius (strain STIR1)

KEGG orthology group: K03101, signal peptidase II [EC: 3.4.23.36] (inferred from 70% identity to dar:Daro_3045)

MetaCyc: 45% identical to lipoprotein signal peptidase (Escherichia coli K-12 substr. MG1655)
Signal peptidase II. [EC: 3.4.23.36]

Predicted SEED Role

"Lipoprotein signal peptidase (EC 3.4.23.36)" in subsystem Sex pheromones in Enterococcus faecalis and other Firmicutes or Signal peptidase (EC 3.4.23.36)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.23.36

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QLB2 at UniProt or InterPro

Protein Sequence (166 amino acids)

>Dsui_3497 lipoprotein signal peptidase (Dechlorosoma suillum PS)
MPKSSLGRWYGLAALVIVLDQLSKWAVLASLNYGDTVTVTPFFDWVFVFNRGAAFSFLAD
QPGWQRWFFTLLALGVSGWIAWMLRQHLAERLLCFSLTLIMGGALGNVIDRVRFGAVVDF
LQFHVAGWYYPAFNVADCAITVGAILLAWEQIRRKPVQGNPDSSAS