Protein Info for Dsui_3496 in Dechlorosoma suillum PS

Annotation: sulfite oxidase-like oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 186 PF00174: Oxidored_molyb" amino acids 25 to 168 (144 residues), 144 bits, see alignment E=1.7e-46

Best Hits

Swiss-Prot: 45% identical to YUIH_BACSU: Uncharacterized oxidoreductase YuiH (yuiH) from Bacillus subtilis (strain 168)

KEGG orthology group: K07147, (no description) (inferred from 66% identity to mep:MPQ_0548)

Predicted SEED Role

"Sulfite oxidase and related enzymes"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QLB1 at UniProt or InterPro

Protein Sequence (186 amino acids)

>Dsui_3496 sulfite oxidase-like oxidoreductase (Dechlorosoma suillum PS)
MSDHRIPPGQRHVTDFPVLDLGIHPDIHHENWQLRLFGLVAQEVVLDWEQLLAMPQVQRT
SDFHCVTTWTRLDVPWEGVLARDVVNLAGPLAEARHVTLHSYDGYTTNVPLAALLDDDVL
VAHTVDDAPLSVEHGGPVRLVLPKRYAWKSAKWLSGIEFHAEDRPGYWEVRGYHNEADPW
KEERYS