Protein Info for Dsui_3480 in Dechlorosoma suillum PS

Annotation: arabinose efflux permease family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 449 transmembrane" amino acids 69 to 90 (22 residues), see Phobius details amino acids 101 to 121 (21 residues), see Phobius details amino acids 133 to 151 (19 residues), see Phobius details amino acids 157 to 177 (21 residues), see Phobius details amino acids 189 to 210 (22 residues), see Phobius details amino acids 214 to 236 (23 residues), see Phobius details amino acids 266 to 288 (23 residues), see Phobius details amino acids 302 to 321 (20 residues), see Phobius details amino acids 329 to 346 (18 residues), see Phobius details amino acids 352 to 369 (18 residues), see Phobius details amino acids 390 to 413 (24 residues), see Phobius details amino acids 419 to 438 (20 residues), see Phobius details PF07690: MFS_1" amino acids 70 to 285 (216 residues), 105.7 bits, see alignment E=2.6e-34 amino acids 268 to 444 (177 residues), 50.6 bits, see alignment E=1.4e-17 PF00083: Sugar_tr" amino acids 101 to 248 (148 residues), 42 bits, see alignment E=6.2e-15

Best Hits

KEGG orthology group: None (inferred from 69% identity to tmz:Tmz1t_3308)

Predicted SEED Role

"Putative transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QL95 at UniProt or InterPro

Protein Sequence (449 amino acids)

>Dsui_3480 arabinose efflux permease family protein (Dechlorosoma suillum PS)
MAFGNPNEWAGGGSVGLRRFSWRRANLLRFTPASSPHPYLLPVSAKPLTAAAPAGDAMTP
EERRAGASLASIFALRMLGLFLILPVFAVYAHTLPSGDNGLLVGLAIGIYGATQALFQIP
YGIASDRFGRKPVIVFGLLLFALGSFIAAAADDLPMIIAGRVLQGAGAISAAVTALAADL
TREQHRTKVMAMIGSSIGLVFALSLVAAPLLYAAIGMAGIFALTGGLALLAIVALYKVVP
PAPKVLVDGGRTRFADVLFHPQLLRLNFGVFVLHLTQTAMWVLIPAALVKTGDLPLAEHW
KVYLPAVLVSFAFMVPAVIAAEKYGRMKMVFNGAVVLLLLVQAGFGLFGQGLWPLALLLT
AFFVAFNILEATQPSLISRIAPVEAKGAALGIYNTTQSLGLFLGGAVGGMLAQRLGGDAV
WWCTGILSLVWLALGLTMKPPVRAQQRPA